PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G145300.3
Common NameB456_004G145300, LOC105791472
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 453aa    MW: 50406.2 Da    PI: 9.6713
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G145300.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14e-08129171346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +WT+eE ++l d+++++  + +  Ia +++++Rt +++k+r+++
  Gorai.004G145300.3 129 KWTKEETDQLFDLCERFDLR-FIIIADRFPTHRTVEELKDRYYS 171
                         8*******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162822.8E-31102176IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007174.7E-8126175IPR001005SANT/Myb domain
SuperFamilySSF466899.79E-7126177IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-6128173IPR009057Homeodomain-like
CDDcd116586.27E-19130172No hitNo description
PfamPF054991.5E-6319381IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MDAKDILGLP KTPLPIPQEK KSRPQKDSQR KPDGISREVY ALTGGVAPLM PSIDVSQLKR  60
RPPSDEKITW QWLPFTSSAR KDDLQLYHWV RVVNGVPPTG DYSFAKYNKS VDVIRYTDEE  120
YEKYLTDPKW TKEETDQLFD LCERFDLRFI IIADRFPTHR TVEELKDRYY SVSRAILVAR  180
APSPGEVAGH PLVKEPYNVT QETERKRALS MVLSQTKHQE RKDAEVLAEA KRIAESRMAA  240
RAAEEPDLPV PSDVGPESAE GAVGPGDTIS PSNVQAPAAA IAPSTSVIAD NASTLASLRM  300
LRVYLRTYAL EQMVQAASSS AGLRTIKRVE QTLQDLGVNL KPKVPTKAVC AEHLELRKEI  360
LTLLNLQKQL QYKEAEGSSF RDGSYGDMPG TAKRSQRAAD QDRTFVPDTI SFGGDRVVKR  420
EQKRKGPGRT SETPSSPAGA HKRPRKMKAS DL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A4e-21101185491DNA methyltransferase 1-associated protein 1
4iej_A4e-21101185491DNA methyltransferase 1-associated protein 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1417423VKREQKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5269187e-51HQ526918.1 Gossypium herbaceum clone NBRI_A2_3058 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475003.10.0PREDICTED: SWR1-complex protein 4 isoform X2
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLA0A0D2PBZ60.0A0A0D2PBZ6_G
STRINGPOPTR_0014s11270.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]